PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00023007-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 356aa    MW: 40600.9 Da    PI: 6.8385
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00023007-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.82.1e-21953145
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        kr en+  rq t++kR+ngi+KKA+ELS+LCd+++ +++fs+tgk
  WALNUT_00023007-RA  9 KRLENTNGRQATYAKRKNGIMKKANELSILCDIDIVLLMFSPTGK 53
                        689****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.221153IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-28160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.06E-24295IPR002100Transcription factor, MADS-box
CDDcd001208.23E-25254No hitNo description
PRINTSPR004042.4E-17323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MGRVKLKIKR LENTNGRQAT YAKRKNGIMK KANELSILCD IDIVLLMFSP TGKPSLCRGV  60
RSSIEEVIAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNVQEFLGTS TQTVEDLTNQ  120
ASTLEARISE IHKRLSYWTN PDKIDSVEHL GQMENSLRES LNQIQTHKEN LQKQQLMSLE  180
CSSQFQHEMH MPFSLGSDQQ LQPLPWIPND DNHHLFLPED PNLLPHRDAE CSTASSLGSY  240
SGYFCTNKNS EIHNSGQENG MLNEFSRIAP MRLQLGAQYP YLPYNLNLMN DTKFQPATQM  300
NPQELPVDYH VNGSFETPRP GYETTQHCWA STSGSGPISM FDEHLYNQVS IKLTFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S6e-13192190Myocyte-specific enhancer factor 2B
1tqe_R6e-13192190Myocyte-specific enhancer factor 2B
1tqe_Q6e-13192190Myocyte-specific enhancer factor 2B
1tqe_P6e-13192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011017371.10.0PREDICTED: MADS-box protein CMB1-like isoform X4
SwissprotQ1PFA41e-117AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLB9HI830.0B9HI83_POPTR; MADS-box family protein
STRINGPOPTR_0008s08780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.21e-118AGAMOUS-like 30